Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II type 1a (AT-1a) receptor
LigandBDBM50003387
Substrate/Competitorn/a
Meas. Tech.ChEMBL_717323
Kd 5.01±n/a nM
Citation Naik, PMurumkar, PGiridhar, RYadav, MR Angiotensin II receptor type 1 (AT1) selective nonpeptidic antagonists--a perspective. Bioorg Med Chem18:8418-56 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II type 1a (AT-1a) receptor
Name:Angiotensin II type 1a (AT-1a) receptor
Synonyms:ANGIOTENSIN AT1 | Angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41009.15
Organism:RABBIT
Description:ANGIOTENSIN AT1 AGTR1 RABBIT::P34976
Residue:359
Sequence:
MMLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLAVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSSKKPVPCFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003387
NameBDBM50003387
Synonyms:2-Ethyl-4-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethoxy]-quinoline | 2-Ethyl-4-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethoxy]-quinoline | CHEMBL284536 | ZD-8731
TypeSmall organic molecule
Emp. Form.C25H21N5O
Mol. Mass.407.4671
SMILESCCc1cc(OCc2ccc(cc2)-c2ccccc2-c2nnn[nH]2)c2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a