Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytosol aminopeptidase
LigandBDBM50336496
Substrate/Competitorn/a
Meas. Tech.ChEMBL_716909
IC50>100000±n/a nM
Citation Albrecht, SAl-Lakkis-Wehbe, MOrsini, ADefoin, APale, PSalomon, ETarnus, CWeibel, JM Amino-benzosuberone: a novel warhead for selective inhibition of human aminopeptidase-N/CD13. Bioorg Med Chem19:1434-49 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytosol aminopeptidase
Name:Cytosol aminopeptidase
Synonyms:LAP | LAPc | Leucine Aminopeptidase | Leucyl aminopeptidase
Type:Homohexamer
Mol. Mass.:56288.28
Organism:Bos taurus (bovine)
Description:Bovine kidney LAPc was purchased from Sigma Chemical Co.
Residue:519
Sequence:
MFLLPLPAAARVAVRHLSVKRLWAPGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFN
KLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGS
EDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWI
EEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMD
LMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQDSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336496
NameBDBM50336496
Synonyms:2-aminocycloheptanone hydrochloride | CHEMBL1668627
TypeSmall organic molecule
Emp. Form.C7H13NO
Mol. Mass.127.1842
SMILESNC1CCCCCC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a