Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMas-related G-protein coupled receptor member X1
LigandBDBM50340747
Substrate/Competitorn/a
Meas. Tech.ChEMBL_740644
IC50 88±n/a nM
Citation Bayrakdarian, MButterworth, JHu, YJSanthakumar, VTomaszewski, MJ Development of 2,4-diaminopyrimidine derivatives as novel SNSR4 antagonists. Bioorg Med Chem Lett21:2102-5 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mas-related G-protein coupled receptor member X1
Name:Mas-related G-protein coupled receptor member X1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36253.68
Organism:Homo sapiens (Human)
Description:ChEMBL_516621
Residue:322
Sequence:
MDPTISTLDTELTPINGTEETLCYKQTLSLTVLTCIVSLVGLTGNAVVLWLLGCRMRRNA
FSIYILNLAAADFLFLSGRLIYSLLSFISIPHTISKILYPVMMFSYFAGLSFLSAVSTER
CLSVLWPIWYRCHRPTHLSAVVCVLLWALSLLRSILEWMLCGFLFSGADSAWCQTSDFIT
VAWLIFLCVVLCGSSLVLLIRILCGSRKIPLTRLYVTILLTVLVFLLCGLPFGIQFFLFL
WIHVDREVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASE
VDEGGGQLPEEILELSGSRLEQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50340747
NameBDBM50340747
Synonyms:2-(4-(2-(4-chlorophenethylamino)pyrimidin-4-yl)piperazin-1-yl)-N-(3-methoxypropyl)-N-(pyridin-4-ylmethyl)acetamide | CHEMBL1762702
TypeSmall organic molecule
Emp. Form.C28H36ClN7O2
Mol. Mass.538.084
SMILESCOCCCN(Cc1ccncc1)C(=O)CN1CCN(CC1)c1ccnc(NCCc2ccc(Cl)cc2)n1
Structure
n/a