Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVEGF-receptor 2 and tyrosine-protein kinase SRC
LigandBDBM8
Substrate/Competitorn/a
Meas. Tech.ChEMBL_742989
IC50 0.6±n/a nM
Citation Pevet, IBrulé, CTizot, AGohier, ACruzalegui, FBoutin, JAGoldstein, S Synthesis and pharmacological evaluation of thieno[2,3-b]pyridine derivatives as novel c-Src inhibitors. Bioorg Med Chem19:2517-28 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
VEGF-receptor 2 and tyrosine-protein kinase SRC
Name:VEGF-receptor 2 and tyrosine-protein kinase SRC
Synonyms:Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src
Type:Protein
Mol. Mass.:59838.60
Organism:Homo sapiens (Human)
Description:P12931
Residue:536
Sequence:
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8
NameBDBM8
Synonyms:(1R)-cyclohexane-1,2-diol | cis-1,2-cyclohexanediol | trans-1,2-cyclohexanediol
TypeSmall organic molecule
Emp. Form.C6H12O2
Mol. Mass.116.1583
SMILESOC1CCCC[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a