Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H4 receptor
LigandBDBM50343023
Substrate/Competitorn/a
Meas. Tech.ChEMBL_744294
Ki 0.9±n/a nM
Citation Meduna, SPSavall, BMCai, HEdwards, JPThurmond, RLMcGovern, PM Triamino pyrimidines and pyridines as histamine H(4) receptor modulators. Bioorg Med Chem Lett21:3113-6 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H4 receptor
Name:Histamine H4 receptor
Synonyms:AXOR35 | G-protein coupled receptor 105 | GPRv53 | HH4R | HISTAMINE H4 | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44517.02
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH4R receptors.
Residue:390
Sequence:
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50343023
NameBDBM50343023
Synonyms:(R)-N2-cyclopentyl-4-(3-(methylamino)pyrrolidin-1-yl)pyridine-2,6-diamine | CHEMBL1770973
TypeSmall organic molecule
Emp. Form.C15H25N5
Mol. Mass.275.3925
SMILESCN[C@@H]1CCN(C1)c1cc(N)nc(NC2CCCC2)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a