Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium/glucose cotransporter 2
LigandBDBM50346263
Substrate/Competitorn/a
Meas. Tech.ChEMBL_750036
EC50 31100±n/a nM
Citation Wu, JSPeng, YHWu, JMHsieh, CJWu, SHCoumar, MSSong, JSLee, JCTsai, CHChen, CTLiu, YWChao, YSWu, SY Discovery of non-glycoside sodium-dependent glucose co-transporter 2 (SGLT2) inhibitors by ligand-based virtual screening. J Med Chem53:8770-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium/glucose cotransporter 2
Name:Sodium/glucose cotransporter 2
Synonyms:Na(+)/glucose cotransporter 2 | Sodium-Dependent Glucose Cotransporter 2 (SGLT2) | Sodium-dependent glucose cotransporter 2 (SGLT2) | Sodium/glucose cotransporter 1 (SGLT1) | Solute carrier family 5 member 2
Type:Protein
Mol. Mass.:72902.00
Organism:Homo sapiens (Human)
Description:P31639
Residue:672
Sequence:
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50346263
n/a
NameBDBM50346263
Synonyms:2-(3-(4-chlorobenzyl)-2-imino-2,3-dihydro-1H-benzo[d]imidazol-1-yl)ethanol | CHEMBL1616222
TypeSmall organic molecule
Emp. Form.C16H16ClN3O
Mol. Mass.301.771
SMILESOCCn1c2ccccc2n(Cc2ccc(Cl)cc2)c1=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: