Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAryl hydrocarbon receptor
LigandBDBM50310361
Substrate/Competitorn/a
Meas. Tech.ChEMBL_750604
EC50 200±n/a nM
Citation Ishikawa, MHashimoto, Y Improvement in aqueous solubility in small molecule drug discovery programs by disruption of molecular planarity and symmetry. J Med Chem54:1539-54 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aryl hydrocarbon receptor
Name:Aryl hydrocarbon receptor
Synonyms:AhR | Class E basic helix-loop-helix protein 76 | aryl hydrocarbon receptor precursor | bHLHe76
Type:PROTEIN
Mol. Mass.:96143.77
Organism:Homo sapiens
Description:ChEMBL_1503828
Residue:848
Sequence:
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLHLEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQFV
PFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYP
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQH
THVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP
DLTSSGFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50310361
NameBDBM50310361
Synonyms:3-(2',6'-Difluorophenyl)-1H-naphtho[2,1-b]pyran-1-one | CHEMBL600169
TypeSmall organic molecule
Emp. Form.C19H10F2O2
Mol. Mass.308.2783
SMILESFc1cccc(F)c1-c1cc(=O)c2c(ccc3ccccc23)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a