Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase
LigandBDBM26193
Substrate/Competitorn/a
Meas. Tech.ChEMBL_757508
Ki 324000±n/a nM
Citation Oztürk Sarikaya, SBTopal, FSentürk, MGülçin, ISupuran, CT In vitro inhibition ofa-carbonic anhydrase isozymes by some phenolic compounds. Bioorg Med Chem Lett21:4259-62 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase
Name:Carbonic anhydrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32973.15
Organism:Dicentrarchus labrax
Description:ChEMBL_757508
Residue:309
Sequence:
MNWLVAALAVCVLVPSANCASDSVAWCYHQPSCNDTTWPTIAAKYCNGTRQSPINIVSAS
AEPNANLTEFTFQNYGDTSILKKILNTGKTVQVSLGSGVSISGGDLSEAYDSLQFHLHWG
KGSSIPGSDGKRYPMELHIVNSKSTFNGNTTLAVKDSTGLAALGFFIEETSGNETQQPAS
WNTLTSYLANITNSGDSVSIAPGISLDDLLVGVDRTKYYRYLGSLTTPQLQEAVVWTVFK
DSIKVSKDLIDLFSTTVHVSNTSSPLMTNVFRNVQPAQPVTTQAASSSATSKTCYSLGLM
ALSLALGRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26193
NameBDBM26193
Synonyms:2-Hydroxybenzoate, I | 2-hydroxybenzoic acid | CHEMBL424 | phenol derivative, 7 | salicylic acid
TypeSmall organic molecule
Emp. Form.C7H6O3
Mol. Mass.138.1207
SMILESOC(=O)c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a