Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 3
LigandBDBM50349676
Substrate/Competitorn/a
Meas. Tech.ChEMBL_760041
IC50 23±n/a nM
Citation Thoma, GBaenteli, RLewis, IJones, DKovarik, JStreiff, MBZerwes, HG Special ergolines efficiently inhibit the chemokine receptor CXCR3 in blood. Bioorg Med Chem Lett21:4745-9 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 3
Name:C-X-C chemokine receptor type 3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40937.37
Organism:Rattus norvegicus
Description:ChEMBL_760041
Residue:367
Sequence:
MYLEVSERQVLDASDIAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPVLYS
LLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAAQWVFGS
GLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDPWVRVALTCIVVWGLCVL
FALPDFIFLSASHDQRLNATHCQYNFPQVGRTALRVLQLVAGFLMPLLVMAYCYAHILAV
LLVSRGQRRFRAMRLVVVVVVAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKS
VTSGMGYMHCCLNPLLYAFVGVKFKEQMWMLLMRLGRSDQRGPQRQPSSSRRESSWSETT
EASYLGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50349676
NameBDBM50349676
Synonyms:CHEMBL1809042
TypeSmall organic molecule
Emp. Form.C33H40N6O2
Mol. Mass.552.7097
SMILESCN1CCN(CCn2cc3C[C@H]4N(C[C@@H](C=C4c4cccc2c34)C(=O)N2CCCC2)C(=O)Nc2ccccc2)CC1 |r,c:15|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a