Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor alpha (PPAR alpha)
LigandBDBM50349811
Substrate/Competitorn/a
Meas. Tech.ChEMBL_760320
EC50 0.1±n/a nM
Citation Raval, PJain, MGoswami, ABasu, SGite, AGodha, APingali, HRaval, SGiri, SSuthar, DShah, MPatel, P Revisiting glitazars: thiophene substituted oxazole containinga-ethoxy phenylpropanoic acid derivatives as highly potent PPARa/¿ dual agonists devoid of adverse effects in rodents. Bioorg Med Chem Lett21:3103-9 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor alpha (PPAR alpha)
Name:Peroxisome proliferator-activated receptor alpha (PPAR alpha)
Synonyms:Nuclear receptor subfamily 1 group C member 1 | PPAR alpha/gamma | PPAR-alpha | Peroxisome Proliferator-Activated Receptor alpha | Peroxisome proliferator-activated receptor
Type:Enzyme
Mol. Mass.:52222.08
Organism:Homo sapiens (Human)
Description:Q07869
Residue:468
Sequence:
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50349811
NameBDBM50349811
Synonyms:CHEMBL1813008
TypeSmall organic molecule
Emp. Form.C21H23NO5S
Mol. Mass.401.476
SMILESCCO[C@@H](Cc1ccc(OCCc2nc(oc2C)-c2cccs2)cc1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a