Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 12
LigandBDBM50153971
Substrate/Competitorn/a
Meas. Tech.ChEMBL_760549
Ki 0.35±n/a nM
Citation Carta, FGaraj, VMaresca, AWagner, JAvvaru, BSRobbins, AHScozzafava, AMcKenna, RSupuran, CT Sulfonamides incorporating 1,3,5-triazine moieties selectively and potently inhibit carbonic anhydrase transmembrane isoforms IX, XII and XIV over cytosolic isoforms I and II: Solution and X-ray crystallographic studies. Bioorg Med Chem19:3105-19 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 12
Name:Carbonic anhydrase
Synonyms:CA-XII | Carbonate dehydratase XII | Carbonic anhydrase 12 (CA XII) | Carbonic anhydrase XII (CA XII) | Carbonic anhydrase XII (CAXII) | Tumor antigen HOM-RCC-3.1.3
Type:Enzyme
Mol. Mass.:39456.00
Organism:Homo sapiens (Human)
Description:Catalytic domain of human cloned isozyme was used in the assay
Residue:354
Sequence:
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50153971
NameBDBM50153971
Synonyms:4-(4,6-Dichloro-[1,3,5]triazin-2-ylamino)-benzenesulfonamide | 4-(4,6-dichloro-1,3,5-triazin-2-ylamino)benzenesulfonamide | CHEMBL366069
TypeSmall organic molecule
Emp. Form.C9H7Cl2N5O2S
Mol. Mass.320.155
SMILESNS(=O)(=O)c1ccc(Nc2nc(Cl)nc(Cl)n2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a