Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-CoA: cholesterol acyltransferase (ACAT)
LigandBDBM50350326
Substrate/Competitorn/a
Meas. Tech.ChEMBL_762141
Ki 2.19±n/a nM
Citation Parkinson, EIJason Hatfield, MTsurkan, LHyatt, JLEdwards, CCHicks, LDYan, BPotter, PM Requirements for mammalian carboxylesterase inhibition by substituted ethane-1,2-diones. Bioorg Med Chem19:4635-43 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-CoA: cholesterol acyltransferase (ACAT)
Name:Acyl-CoA: cholesterol acyltransferase (ACAT)
Synonyms:Acyl coenzyme A:cholesterol acyltransferase | Serine hydrolase (CES1)
Type:Protein
Mol. Mass.:62520.83
Organism:Homo sapiens (Human)
Description:n/a
Residue:567
Sequence:
MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPL
GPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN
IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLK
MKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP
MQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDL
IADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPF
LKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLK
DKEVAFWTNLFAKKAVEKPPQTEHIEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50350326
n/a
NameBDBM50350326
Synonyms:CHEMBL1812864
TypeSmall organic molecule
Emp. Form.C14H18O2
Mol. Mass.218.2915
SMILESCCCCCCC(=O)C(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: