Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V1b receptor
LigandBDBM50350844
Substrate/Competitorn/a
Meas. Tech.ChEMBL_763491
EC50 26±n/a nM
Citation Wisniewski, KGalyean, RTariga, HAlagarsamy, SCroston, GHeitzmann, JKohan, AWisniewska, HLaporte, RRivière, PJSchteingart, CD New, potent, selective, and short-acting peptidic V1a receptor agonists. J Med Chem54:4388-98 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V1b receptor
Name:Vasopressin V1b receptor
Synonyms:AVPR V1b | AVPR V3 | Antidiuretic hormone receptor 1b | V1bR | VASOPRESSIN V1B | Vasopressin V3 | Vasopressin V3 receptor
Type:Enzyme
Mol. Mass.:46985.01
Organism:Homo sapiens (Human)
Description:P47901
Residue:424
Sequence:
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
SGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVG
GGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQ
PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
TIIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50350844
NameBDBM50350844
Synonyms:CHEMBL1817697
TypeSmall organic molecule
Emp. Form.C43H67N13O12S2
Mol. Mass.1022.202
SMILESCC[C@H](C)[C@@H]1NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](N)CSSC[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(=O)NCCO)NC1=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN)C(=O)NCC(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a