Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBcl-xL/BAK
LigandBDBM50352199
Substrate/Competitorn/a
Meas. Tech.ChEMBL_767333
Kd 3.784E5±n/a nM
Citation Rega, MFWu, BWei, JZhang, ZCellitti, JFPellecchia, M SAR by interligand nuclear overhauser effects (ILOEs) based discovery of acylsulfonamide compounds active against Bcl-x(L) and Mcl-1. J Med Chem54:6000-13 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bcl-xL/BAK
Name:Bcl-xL/BAK
Synonyms:Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | BCL2-like 1 isoform 1 | Bcl-2-like protein 1 | Bcl-2-like protein 1 (Bcl-XL) | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD)
Type:Mitochondrion membrane; Single-pass membrane protein
Mol. Mass.:26039.60
Organism:Homo sapiens
Description:n/a
Residue:233
Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50352199
NameBDBM50352199
Synonyms:CHEMBL1824799
TypeSmall organic molecule
Emp. Form.C12H15NO2
Mol. Mass.205.253
SMILESOC(=O)c1ccccc1N1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a