Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Aurora-C
LigandBDBM50352297
Substrate/Competitorn/a
Meas. Tech.ChEMBL_766654
Kd 4±n/a nM
Citation Abraham, SHadd, MJTran, LVickers, TSindac, JMilanov, ZVHolladay, MWBhagwat, SSHua, HFord Pulido, JMCramer, MDGitnick, DJames, JDao, ABelli, BArmstrong, RCTreiber, DKLiu, G Novel series of pyrrolotriazine analogs as highly potent pan-Aurora kinase inhibitors. Bioorg Med Chem Lett21:5296-300 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Aurora-C
Name:Serine/threonine-protein kinase Aurora-C
Synonyms:Aurora kinase C | Aurora kinase C (AURKC) | Aurora-C | Aurora/Ipl1-related kinase 3 | Aurora/Ipl1/Eg2 protein 2 | Serine/threonine-protein kinase 13
Type:Enzyme
Mol. Mass.:35602.43
Organism:Homo sapiens (Human)
Description:Amino acid residues 1-309 were expressed as His-tagged fusion protein using baculovirus expression system.
Residue:309
Sequence:
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLA
RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
LPPCAQMAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50352297
NameBDBM50352297
Synonyms:CHEMBL1822485
TypeSmall organic molecule
Emp. Form.C20H19N7OS
Mol. Mass.405.476
SMILESCc1cc(Nc2nc(Sc3ccc(NC(=O)C4CC4)cc3)nn3cccc23)n[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a