Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetStearoyl-CoA desaturase 1 (SCD1)
LigandBDBM50354682
Substrate/Competitorn/a
Meas. Tech.ChEMBL_771237
IC50 1±n/a nM
Citation Ramtohul, YKPowell, DLeclerc, JPLeger, SOballa, RBlack, CIsabel, ELi, CSCrane, SRobichaud, JGuay, JGuiral, SZhang, LHuang, Z Bicyclic heteroaryl inhibitors of stearoyl-CoA desaturase: from systemic to liver-targeting inhibitors. Bioorg Med Chem Lett21:5692-6 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Stearoyl-CoA desaturase 1 (SCD1)
Name:Stearoyl-CoA desaturase 1 (SCD1)
Synonyms:Acyl-CoA desaturase 1
Type:Enzyme
Mol. Mass.:41485.97
Organism:Rattus norvegicus (Rat)
Description:P07308
Residue:358
Sequence:
MPAHMLQEISSSYTTTTTITEPPSGNLQNGREKMKKVPLYLEEDIRPEMREDIHDPSYQD
EEGPPPKLEYVWRNIILMALLHVGALYGITLIPSSKVYTLLWGIFYYLISALGITAGAHR
LWSHRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSH
VGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGET
FLHSLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYH
HAFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAVLARIKRTGDGSHKSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50354682
n/a
NameBDBM50354682
Synonyms:CHEMBL1834455
TypeSmall organic molecule
Emp. Form.C16H15BrFN5O
Mol. Mass.392.226
SMILESFc1ccc(Br)c(OC2CCN(CC2)c2ncnc3nc[nH]c23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: