Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAKT/p21CIP1
LigandBDBM50355393
Substrate/Competitorn/a
Meas. Tech.ChEMBL_773550
IC50>10000±n/a nM
Citation Guagnano, VFuret, PSpanka, CBordas, VLe Douget, MStamm, CBrueggen, JJensen, MRSchnell, CSchmid, HWartmann, MBerghausen, JDrueckes, PZimmerlin, ABussiere, DMurray, JGraus Porta, D Discovery of 3-(2,6-dichloro-3,5-dimethoxy-phenyl)-1-{6-[4-(4-ethyl-piperazin-1-yl)-phenylamino]-pyrimidin-4-yl}-1-methyl-urea (NVP-BGJ398), a potent and selective inhibitor of the fibroblast growth factor receptor family of receptor tyrosine kinase. J Med Chem54:7066-83 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AKT/p21CIP1
Name:AKT/p21CIP1
Synonyms:AKT phosphorylation (p-AKT) | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | Proto-oncogene c-Akt (AKT1) | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT)
Type:Enzyme
Mol. Mass.:55681.25
Organism:Homo sapiens (human)
Description:n/a
Residue:480
Sequence:
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50355393
n/a
NameBDBM50355393
Synonyms:CHEMBL1834657 | US9434697, BGJ398
TypeSmall organic molecule
Emp. Form.C26H31Cl2N7O3
Mol. Mass.560.475
SMILESCCN1CCN(CC1)c1ccc(Nc2cc(ncn2)N(C)C(=O)Nc2c(Cl)c(OC)cc(OC)c2Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: