Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFocal adhesion kinase 1/vascular endothelial growth factor receptor 3
LigandBDBM50355393
Substrate/Competitorn/a
Meas. Tech.ChEMBL_773509
IC50>10000±n/a nM
Citation Guagnano, VFuret, PSpanka, CBordas, VLe Douget, MStamm, CBrueggen, JJensen, MRSchnell, CSchmid, HWartmann, MBerghausen, JDrueckes, PZimmerlin, ABussiere, DMurray, JGraus Porta, D Discovery of 3-(2,6-dichloro-3,5-dimethoxy-phenyl)-1-{6-[4-(4-ethyl-piperazin-1-yl)-phenylamino]-pyrimidin-4-yl}-1-methyl-urea (NVP-BGJ398), a potent and selective inhibitor of the fibroblast growth factor receptor family of receptor tyrosine kinase. J Med Chem54:7066-83 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Focal adhesion kinase 1/vascular endothelial growth factor receptor 3
Name:Focal adhesion kinase 1/vascular endothelial growth factor receptor 3
Synonyms:FADK 1 | FLT4 | Focal adhesion kinase (FAK) | Focal adhesion kinase (PTK2) | Focal adhesion kinase 1 | Focal adhesion kinase 1 (FADK 1) (pp125FAK) (Protein-tyrosine kinase 2). | Focal adhesion kinase 1 (FAK) | PTK2 | PTK2 protein tyrosine kinase 2 | Protein phosphatase 1 regulatory subunit 71 | Protein-tyrosine kinase 2 | Protein-tyrosine kinase 2 (PTK2) | Tyrosine Kinase FAK | Vascular endothelial growth factor receptor 3 (VEGFR3) | pp125FAK
Type:Tyrosine-protein kinase
Mol. Mass.:119233.17
Organism:Homo sapiens (human)
Description:n/a
Residue:1052
Sequence:
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50355393
n/a
NameBDBM50355393
Synonyms:CHEMBL1834657 | US9434697, BGJ398
TypeSmall organic molecule
Emp. Form.C26H31Cl2N7O3
Mol. Mass.560.475
SMILESCCN1CCN(CC1)c1ccc(Nc2cc(ncn2)N(C)C(=O)Nc2c(Cl)c(OC)cc(OC)c2Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: