Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 3
LigandBDBM5445
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774546
Kd>10000±n/a nM
Citation Davis, MIHunt, JPHerrgard, SCiceri, PWodicka, LMPallares, GHocker, MTreiber, DKZarrinkar, PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 3
Name:Interleukin-1 receptor-associated kinase 3
Synonyms:IL-1 receptor-associated kinase M | IRAK-3 | IRAK-M
Type:PROTEIN
Mol. Mass.:67767.98
Organism:Homo sapiens
Description:ChEMBL_774546
Residue:596
Sequence:
MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEK
YVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGG
FPNILFKETANVTVDNVLIPEHNEKGILLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVY
RVEIQNLTYAVKLFKQEKKMQCKKHWKRFLSELEVLLLFHHPNILELAAYFTETEKFCLI
YPYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHYLHNVQPCSVICGSISSANIL
LDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGKLSIKTDVYSF
GIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC
LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVE
DDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCE
ESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5445
NameBDBM5445
Synonyms:CHEMBL554 | GW572016 | LAPATINIB DITOSYLATE | Lapatinib | N-{3-chloro-4-[(3-fluoro-benzyl)oxy]phenyl}-6-[5-({2-(methylsulfonyl)ethyl]amino}methyl)-2-furyl]-4-quinazolinamine | N-{3-chloro-4-[(3-fluorophenyl)methoxy]phenyl}-6-(5-{[(2-methanesulfonylethyl)amino]methyl}furan-2-yl)quinazolin-4-amine | Tykerb | cid_208908
TypeSmall organic molecule
Emp. Form.C29H26ClFN4O4S
Mol. Mass.581.058
SMILESCS(=O)(=O)CCNCc1ccc(o1)-c1ccc2ncnc(Nc3ccc(OCc4cccc(F)c4)c(Cl)c3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a