Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase catalytic subunit alpha-1
LigandBDBM50026612
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774253
Kd 87±n/a nM
Citation Davis, MIHunt, JPHerrgard, SCiceri, PWodicka, LMPallares, GHocker, MTreiber, DKZarrinkar, PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase catalytic subunit alpha-1
Name:5'-AMP-activated protein kinase catalytic subunit alpha-1
Synonyms:5''-AMP-activated protein kinase catalytic subunit alpha-1 (AMPKa1) | 5''-AMP-activated protein kinase subunit alpha-1 | ACACA kinase | AMP-activated protein kinase, alpha-1 subunit | AMPK subunit alpha-1 | AMPK-alpha1 | Hydroxymethylglutaryl-CoA reductase kinase | Tau-protein kinase PRKAA1
Type:Protein
Mol. Mass.:64023.62
Organism:Homo sapiens (Human)
Description:Q13131
Residue:559
Sequence:
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026612
NameBDBM50026612
Synonyms:BIBF-1120 | NINTEDANIB | Nintedanib | Vargatef
TypeSmall organic molecule
Emp. Form.C31H33N5O4
Mol. Mass.539.6248
SMILESCOC(=O)c1ccc2\C(=C(\Nc3ccc(cc3)N(C)C(=O)CN3CCN(C)CC3)c3ccccc3)C(=O)Nc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a