Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChaperone activity of bc1 complex-like, mitochondrial
LigandBDBM60589
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774596
Kd>10000±n/a nM
Citation Davis, MIHunt, JPHerrgard, SCiceri, PWodicka, LMPallares, GHocker, MTreiber, DKZarrinkar, PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chaperone activity of bc1 complex-like, mitochondrial
Name:Chaperone activity of bc1 complex-like, mitochondrial
Synonyms:ADCK3
Type:PROTEIN
Mol. Mass.:71954.89
Organism:Homo sapiens
Description:ChEMBL_655673
Residue:647
Sequence:
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQG
QDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPDQSAPPSLGHAHSEGPAPAYV
ASGPFREAGFPGQASSPLGRANGRLFANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEK
ARQAKARPENKQHKQTLSEHARERKVPVTRIGRLANFGGLAVGLGFGALAEVAKKSLRSE
DPSGKKAVLGSSPFLSEANAERIVRTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERV
RQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQ
YPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRD
LLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELF
EFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAK
SIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLV
PPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60589
n/a
NameBDBM60589
Synonyms:6-{[6-(1-methyl-1H-pyrazol-4-yl)-[1,2,4]triazolo[4,3-b]pyridazin-3-yl]sulfanyl}quinoline (4) | BDBM50355498
Typen/a
Emp. Form.C18H13N7S
Mol. Mass.359.408
SMILESCn1cc(cn1)-c1ccc2nnc(Sc3ccc4ncccc4c3)n2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: