Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEphrin receptor
LigandBDBM60665
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774433
Kd 39±n/a nM
Citation Davis, MIHunt, JPHerrgard, SCiceri, PWodicka, LMPallares, GHocker, MTreiber, DKZarrinkar, PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ephrin receptor
Name:Ephrin receptor
Synonyms:EHK-2 | EHK2 | EK12 | EPH homology kinase 2 | EPH-like kinase 12 | EPHA6 | Ephrin type-A receptor 6 | HEK12
Type:PROTEIN
Mol. Mass.:116385.76
Organism:Homo sapiens
Description:ChEMBL_774228
Residue:1036
Sequence:
MGGCEVREFLLQFGFFLPLLTAWPGDCSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAI
TEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGT
CKETFNLFYMESDESHGIKFKPNQYTKIDTIAADESFTQMDLGDRILKLNTEIREVGPIE
RKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSA
EERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHS
LTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSDTGGR
KDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNG
VSELSFSPKPFTAITVTTDQDAPSLIGVVRKDWASQNSIALSWQAPAFSNGAILDYEIKY
YEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHIRVRTATGYSGYSQKFEFETGDETSD
MAAEQGQILVIATAAVGGFTLLVILTLFFLITGRCQWYIKAKMKSEEKRRNHLQNGHLRF
PGIKTYIDPDTYEDPSLAVHEFAKEIDPSRIRIERVIGAGEFGEVCSGRLKTPGKREIPV
AIKTLKGGHMDRQRRDFLREASIMGQFDHPNIIRLEGVVTKRSFPAIGVEAFCPSFLRAG
FLNSIQAPHPVPGGGSLPPRIPAGRPVMIVVEYMENGSLDSFLRKHDGHFTVIQLVGMLR
GIASGMKYLSDMGYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAAYTTTGGKIPI
RWTAPEAIAYRKFSSASDAWSYGIVMWEVMSYGERPYWEMSNQDVILSIEEGYRLPAPMG
CPASLHQLMLHCWQKERNHRPKFTDIVSFLDKLIRNPSALHTLVEDILVMPESPGEVPEY
PLFVTVGDWLDSIKMGQYKNNFVAAGFTTFDLISRMSIDDIRRIGVILIGHQRRIVSSIQ
TLRLHMMHIQEKGFHV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60665
NameBDBM60665
Synonyms:BDBM50249542 | US9145414, R406 | US9212178, R406
Typen/a
Emp. Form.C22H23FN6O5
Mol. Mass.470.4536
SMILESCOc1cc(Nc2ncc(F)c(Nc3ccc4OC(C)(C)C(=O)Nc4n3)n2)cc(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a