Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTGF-beta receptor type I
LigandBDBM60665
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774441
Kd 2600±n/a nM
Citation Davis, MIHunt, JPHerrgard, SCiceri, PWodicka, LMPallares, GHocker, MTreiber, DKZarrinkar, PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
TGF-beta receptor type I
Name:TGF-beta receptor type I
Synonyms:ALK-5 | ALK5 | ALK5 | ALK5/TGFBR1 | Activin A receptor type II-like protein kinase of 53kD | Activin receptor-like kinase 5 | Activin receptor-like kinase 5 (ALK-5) | Activin receptor-like kinase 5 (ALK5/TGFbeta) | P36897 | SKR4 | TGF-beta receptor type-1 | TGF-beta receptor type-1 (TGFR1) | TGFBR1 | Transforming Growth Factor
Type:n/a
Mol. Mass.:55968.24
Organism:Homo sapiens
Description:n/a
Residue:503
Sequence:
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60665
NameBDBM60665
Synonyms:BDBM50249542 | US9145414, R406 | US9212178, R406
Typen/a
Emp. Form.C22H23FN6O5
Mol. Mass.470.4536
SMILESCOc1cc(Nc2ncc(F)c(Nc3ccc4OC(C)(C)C(=O)Nc4n3)n2)cc(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a