Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase alpha 5
LigandBDBM60665
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774447
Kd 150±n/a nM
Citation Davis, MIHunt, JPHerrgard, SCiceri, PWodicka, LMPallares, GHocker, MTreiber, DKZarrinkar, PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosomal protein S6 kinase alpha 5
Name:Ribosomal protein S6 kinase alpha 5
Synonyms:90 kDa ribosomal protein S6 kinase 5 | Mitogen- and Stress-Activated Protein Kinase 1 (MSK1) | Nuclear mitogen- and stress-activated protein kinase 1 | Nuclear mitogen- and stress-activated protein kinase 1 (MSK1) | RPS6KA5(Kin.Dom.2 - C-terminal) | RSK-like protein kinase | RSKL | Ribosomal protein S6 kinase alpha-5
Type:Serine/threonine-protein kinase
Mol. Mass.:89874.44
Organism:Homo sapiens (human)
Description:n/a
Residue:802
Sequence:
MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAY
GKVFLVRKISGHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYA
FQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKL
ENILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWS
LGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALAKDLIQRLLMKDPKK
RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYS
PAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPN
IVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGV
VHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYD
ESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEA
KDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFH
AFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTL
QPSNPADSNNPETLFQFSDSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60665
n/a
NameBDBM60665
Synonyms:BDBM50249542 | US9145414, R406 | US9212178, R406
Typen/a
Emp. Form.C22H23FN6O5
Mol. Mass.470.4536
SMILESCOc1cc(Nc2ncc(F)c(Nc3ccc4OC(C)(C)C(=O)Nc4n3)n2)cc(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: