Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnkyrin repeat and protein kinase domain-containing protein 1
LigandBDBM25084
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774215
Kd>10000±n/a nM
Citation Davis, MIHunt, JPHerrgard, SCiceri, PWodicka, LMPallares, GHocker, MTreiber, DKZarrinkar, PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ankyrin repeat and protein kinase domain-containing protein 1
Name:Ankyrin repeat and protein kinase domain-containing protein 1
Synonyms:ANKK1
Type:PROTEIN
Mol. Mass.:84641.10
Organism:Homo sapiens
Description:ChEMBL_587171
Residue:765
Sequence:
MAADPTELRLGSLPVFTRDDFEGDWRLVASGGFSQVFQARHRRWRTEYAIKCAPCLPPDA
ASSDVNYLIEEAAKMKKIKFQHIVSIYGVCKQPLGIVMEFMANGSLEKVLSTHSLCWKLR
FRIIHETSLAMNFLHSIKPPLLHLDLKPGNILLDSNMHVKISDFGLSKWMEQSTRMQYIE
RSALRGMLSYIPPEMFLESNKAPGPKYDVYSFAIVIWELLTQKKPYSGFNMMMIIIRVAA
GMRPSLQPVSDQWPSEAQQMVDLMKRCWDQDPKKRPCFLDITIETDILLSLLQSRVAVPE
SKALARKVSCKLSLRQPGEVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYE
NKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGAD
ANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLL
VSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKV
RAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLA
AYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGW
TPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAALKGNTAILKVLVEAGAQLDV
QDGVSCTPLQLALRSRKQGIMSFLEGKEPSVATLGGSKPGAEMEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25084
n/a
NameBDBM25084
Synonyms:3-[2,4-diamino-6-(3-hydroxyphenyl)pteridin-7-yl]phenol | JMC504279 Compound 6 | TG100-115
TypeSmall organic molecule
Emp. Form.C18H14N6O2
Mol. Mass.346.3428
SMILESNc1nc(N)c2nc(-c3cccc(O)c3)c(nc2n1)-c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: