Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase PRKX
LigandBDBM5655
Substrate/Competitorn/a
Meas. Tech.ChEMBL_774456
Kd>10000±n/a nM
Citation Davis, MIHunt, JPHerrgard, SCiceri, PWodicka, LMPallares, GHocker, MTreiber, DKZarrinkar, PP Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol29:1046-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase PRKX
Name:Serine/threonine-protein kinase PRKX
Synonyms:PRKX | Serine/threonine-protein kinase PRKX
Type:Enzyme Catalytic Domain
Mol. Mass.:40897.91
Organism:Homo sapiens
Description:gi_4826948
Residue:358
Sequence:
MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFDTLATVGTGTF
GRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDER
FLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILL
DRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSG
FPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHH
RWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5655
NameBDBM5655
Synonyms:2-(2-chlorophenyl)-5,7-dihydroxy-8-[(3S,4R)-3-hydroxy-1-methylpiperidin-4-yl]-4H-chromen-4-one | CHEMBL428690 | Flavopiridol
TypeSmall organic molecule
Emp. Form.C21H20ClNO5
Mol. Mass.401.84
SMILESCN1CC[C@@H]([C@H](O)C1)c1c(O)cc(O)c2c1oc(cc2=O)-c1ccccc1Cl |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a