Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase PIM
LigandBDBM50335638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_788035
IC50 186±n/a nM
Citation Pierre, FStefan, ENédellec, ASChevrel, MCRegan, CFSiddiqui-Jain, AMacalino, DStreiner, NDrygin, DHaddach, MO'Brien, SEAnderes, KRyckman, DM 7-(4H-1,2,4-Triazol-3-yl)benzo[c][2,6]naphthyridines: a novel class of Pim kinase inhibitors with potent cell antiproliferative activity. Bioorg Med Chem Lett21:6687-92 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase PIM
Name:Serine/threonine-protein kinase PIM
Synonyms:Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase Pim-2 | Serine/threonine-protein kinase pim-1 (PIM2) | Serine/threonine-protein kinase pim-2 (PIM2)
Type:Serine/threonine-protein kinase
Mol. Mass.:34185.93
Organism:Homo sapiens (human)
Description:n/a
Residue:311
Sequence:
MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50335638
n/a
NameBDBM50335638
Synonyms:5-(3-Chlorophenylamino)benzo[c][2,6]naphthyridine-8-carboxylic acid | 5-[(3-chlorophenyl)amino]benzo[c][2,6]naphthyridine-8-carboxylic acid | CHEMBL1230165 | US9062043, Table 13, Compound 17 | US9062043, Table 20b, Compound 12
TypeSmall organic molecule
Emp. Form.C19H12ClN3O2
Mol. Mass.349.77
SMILESOC(=O)c1ccc2c(c1)nc(Nc1cccc(Cl)c1)c1ccncc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: