Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphatidylinositol 4-kinase beta (PIK4KB)
LigandBDBM50358204
Substrate/Competitorn/a
Meas. Tech.ChEMBL_790101
IC50>10000±n/a nM
Citation Sutherlin, DPBao, LBerry, MCastanedo, GChuckowree, IDotson, JFolks, AFriedman, LGoldsmith, RGunzner, JHeffron, TLesnick, JLewis, CMathieu, SMurray, JNonomiya, JPang, JPegg, NPrior, WWRouge, LSalphati, LSampath, DTian, QTsui, VWan, NCWang, SWei, BWiesmann, CWu, PZhu, BYOlivero, A Discovery of a potent, selective, and orally available class I phosphatidylinositol 3-kinase (PI3K)/mammalian target of rapamycin (mTOR) kinase inhibitor (GDC-0980) for the treatment of cancer. J Med Chem54:7579-87 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphatidylinositol 4-kinase beta (PIK4KB)
Name:Phosphatidylinositol 4-kinase, PI4K
Synonyms:PI4-kinase beta subunit | Phosphatidylinositol 4-kinase, PI4K
Type:Protein
Mol. Mass.:91373.30
Organism:Homo sapiens (Human)
Description:n/a
Residue:816
Sequence:
MGDTVVEPAPLKPTSEPTSGPPGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVK
LLHGGVAVSSRGTPLELVNGDGVDSEIRCLDDPPAQIREEEDEMGAAVASGTAKGARRRR
QNNSAKQSWLLRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFCFRNEDVDFYLPQLL
NMYIHMDEDVGDAIKPYIVHRCRQSINFSLQCALLLGAYSSDMHISTQRHSRGTKLRKLI
LSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSNLKRTASNPKVEN
EDEELSSSTESIDNSFSSPVRLAPEREFIKSLMAIGKRLATLPTKEQKTQRLISELSLLN
HKLPARVWLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFDTTSVPARIPE
NRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQVELPEVHTNSCD
NISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEK
VRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKI
LVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGY
CLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGG
LDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSM
TEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50358204
n/a
NameBDBM50358204
Synonyms:CHEMBL1922094
TypeSmall organic molecule
Emp. Form.C23H30N8O3S
Mol. Mass.498.601
SMILESC[C@H](O)C(=O)N1CCN(Cc2sc3c(nc(nc3c2C)-c2cnc(N)nc2)N2CCOCC2)CC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: