Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrace amine-associated receptor 1 (TAAR1)
LigandBDBM50010588
Substrate/Competitorn/a
Meas. Tech.ChEMBL_792738
EC50 1700±n/a nM
Citation Lewin, AHMiller, GMGilmour, B Trace amine-associated receptor 1 is a stereoselective binding site for compounds in the amphetamine class. Bioorg Med Chem19:7044-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trace amine-associated receptor 1 (TAAR1)
Name:Trace amine-associated receptor 1
Synonyms:Trace amine receptor 1 (TARR1) | Trace amine-associated receptor1
Type:Enzyme
Mol. Mass.:38034.73
Organism:Rattus norvegicus (Rat)
Description:Q923Y9
Residue:332
Sequence:
MHLCHNSANISHTNSNWSRDVRASLYSLISLIILTTLVGNLIVIISISHFKQLHTPTNWL
LHSMAVVDFLLGCLVMPYSMVRTVEHCWYFGELFCKLHTSTDIMLSSASILHLAFISIDR
YYAVCDPLRYKAKINLAAIFVMILISWSLPAVFAFGMIFLELNLEGVEELYHNQVFCLRG
CFPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRANLQVGLEGESRAPQ
SKETKAAKTLGIMVGVFLLCWCPFFFCMVLDPFLGYVIPPTLNDTLNWFGYLNSAFNPMV
YAFFYPWFRRALKMVLFGKIFQKDSSRSKLFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010588
NameBDBM50010588
Synonyms:(RS)-3,4-(methylenedioxy)methamphetamine | 1-(1,3-Benzodioxol-5-yl)-N-methyl-2-propanamine | 1-(1,3-benzodioxol-5-yl)-N-methylpropan-2-amine | 3,4-methylenedioxymethamphetamine | CHEMBL43048 | DL-(3,4-Methylenedioxy)methamphetamine | MDMA | N,alpha-dimethyl-1,3-benzodioxole-5-ethanamine | N-Methyl-3,4-methylenedioxyamphetamine
TypeSmall organic molecule
Emp. Form.C11H15NO2
Mol. Mass.193.2423
SMILESCNC(C)Cc1ccc2OCOc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a