Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRAC-alpha serine/threonine-protein kinase AKT1
LigandBDBM50361650
Substrate/Competitorn/a
Meas. Tech.ChEMBL_799352
Ki 230±n/a nM
Citation Murphy, STAlton, GBailey, SBaxi, SMBurke, BJChappie, TAErmolieff, JFerre, RGreasley, SHickey, MHumphrey, JKablaoui, NKath, JKazmirski, SKraus, MKupchinsky, SLi, JLingardo, LMarx, MARichter, DTanis, SPTran, KVernier, WXie, ZYin, MJYu, XH Discovery of novel, potent, and selective inhibitors of 3-phosphoinositide-dependent kinase (PDK1). J Med Chem54:8490-500 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
RAC-alpha serine/threonine-protein kinase AKT1
Name:RAC-alpha serine/threonine-protein kinase AKT1
Synonyms:AKT phosphorylation (p-AKT) | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | Proto-oncogene c-Akt (AKT1) | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT)
Type:Enzyme
Mol. Mass.:55681.25
Organism:Homo sapiens (Human)
Description:n/a
Residue:480
Sequence:
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50361650
NameBDBM50361650
Synonyms:CHEMBL1940248
TypeSmall organic molecule
Emp. Form.C24H24FN7O2
Mol. Mass.461.4915
SMILESCC(C)n1cc(C(=O)c2cncc(N[C@@H]3CCO[C@@H]3c3ccc(F)cc3)n2)c2c(N)ncnc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a