Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (AR)
LigandBDBM4374
Substrate/Competitorn/a
Meas. Tech.ChEMBL_798533
IC50 76000±n/a nM
Citation Soda, MHu, DEndo, STakemura, MLi, JWada, RIfuku, SZhao, HTEl-Kabbani, OOhta, SYamamura, KToyooka, NHara, AMatsunaga, T Design, synthesis and evaluation of caffeic acid phenethyl ester-based inhibitors targeting a selectivity pocket in the active site of human aldo-keto reductase 1B10. Eur J Med Chem48:321-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase (AR)
Name:Aldose reductase
Synonyms:AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase
Type:Protein
Mol. Mass.:35855.50
Organism:Homo sapiens (Human)
Description:P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0
Residue:316
Sequence:
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4374
NameBDBM4374
Synonyms:(2E)-3-(4-hydroxyphenyl)prop-2-enoic acid | (2E)-3-(4-hydroxyphenyl)prop-2-enoic acid (8) | CHEMBL66879 | p-Coumaric Acid | p-Hydroxycinnamic acid (p-HCA) | p-hydroxycinnamic acid | p-hydroxycinnamic acid (M4)
TypeSmall organic molecule
Emp. Form.C9H8O3
Mol. Mass.164.158
SMILESOC(=O)\C=C\c1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a