Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 12
LigandBDBM10860
Substrate/Competitorn/a
Meas. Tech.ChEMBL_807745
Ki 0.3±n/a nM
Citation Moeker, JTeruya, KRossit, SWilkinson, BLLopez, MBornaghi, LFInnocenti, ASupuran, CTPoulsen, SA Design and synthesis of thiourea compounds that inhibit transmembrane anchored carbonic anhydrases. Bioorg Med Chem20:2392-404 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 12
Name:Carbonic anhydrase
Synonyms:CA-XII | Carbonate dehydratase XII | Carbonic anhydrase 12 (CA XII) | Carbonic anhydrase XII (CA XII) | Carbonic anhydrase XII (CAXII) | Tumor antigen HOM-RCC-3.1.3
Type:Enzyme
Mol. Mass.:39456.00
Organism:Homo sapiens (Human)
Description:Catalytic domain of human cloned isozyme was used in the assay
Residue:354
Sequence:
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10860
NameBDBM10860
Synonyms:4-(aminomethyl)benzene-1-sulfonamide | CHEMBL419 | MAFENIDE | aromatic sulfonamide compound 6 | aromatic/heteroaromatic sulfonamide 5 | hCA inhibitor, 9
TypeSmall organic molecule
Emp. Form.C7H10N2O2S
Mol. Mass.186.232
SMILESNCc1ccc(cc1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a