BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-L-fucosidase I
LigandBDBM18351
Substrate/Competitorn/a
Meas. Tech.ChEBML_33962
Ki>100000000±n/a nM
Citation Dumas, DPKajimoto, TLiu, KKWong, CBerkowitz, DBDanieshefsky, SJ Azasugar and glycal inhibitors of -L-fucosidase Bioorg Med Chem Lett2:33-36 (1992)    Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-L-fucosidase I
Name:Alpha-L-fucosidase I
Synonyms:Alpha-L-fucoside fucohydrolase | Tissue alpha-L-fucosidase
Type:PROTEIN
Mol. Mass.:53690.69
Organism:Homo sapiens
Description:ChEMBL_34088
Residue:466
Sequence:
MRAPGMRSRPAGPALLLLLLFLGAAESVRRAQPPRRYTPDWPSLDSRPLPAWFDEAKFGV
FIHWGVFSVPAWGSEWFWWHWQGEGRPQYQRFMRDNYPPGFSYADFGPQFTARFFHPEEW
ADLFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYG
LYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYW
NSTNFLSWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCEDKFKPQSLPDHKWEMCTSID
KFSWGYRRDMALSDVTEESEIISELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGK
WLSINGEAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTK
ITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18351
NameBDBM18351
Synonyms:(2R,3R,4R,5S)-2-(Hydroxymethyl)piperidine-3,4,5-triol, 10 | (2R,3R,4R,5S)-2-(hydroxymethyl)piperidine-3,4,5-triol | 1-Deoxynojirimycin | 1-deoxynojirimycin (DNJ) | CHEMBL307429 | US9181184, 1 | dNM
Typenatural product
Emp. Form.C6H13NO4
Mol. Mass.163.1717
SMILESOC[C@H]1NC[C@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM18351
Synonyms:(2R,3R,4R,5S)-2-(Hydroxymethyl)piperidine-3,4,5-triol, 10 | (2R,3R,4R,5S)-2-(hydroxymethyl)piperidine-3,4,5-triol | 1-Deoxynojirimycin | 1-deoxynojirimycin (DNJ) | CHEMBL307429 | US9181184, 1 | dNM
Typenatural product
Emp. Form.C6H13NO4
Mol. Mass.163.1717
SMILESOC[C@H]1NC[C@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: