BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurotensin receptor 1
LigandBDBM50366304
Substrate/Competitorn/a
Meas. Tech.ChEBML_144304
Ki 1000±n/a nM
Citation Cain, GAChristos, TEJohnson, ALPottorf, RSConfalone, PNWilliam Tam, SSchmidt, WK Neurotensin receptor binding and antinociceptive activity for lipophilic N-amido neurotensin(913) analogs Bioorg Med Chem Lett3:2055-2060 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Neurotensin receptor 1
Name:Neurotensin receptor 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:47070.64
Organism:Rattus norvegicus
Description:ChEMBL_1466612
Residue:424
Sequence:
MHLNSSVPQGTPGEPDAQPFSGPQSEMEATFLALSLSNGSGNTSESDTAGPNSDLDVNTD
IYSKVLVTAIYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLA
MPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTL
MSRSRTKKFISAIWLASALLAIPMLFTMGLQNRSGDGTHPGGLVCTPIVDTATVKVVIQV
NTFMSFLFPMLVISILNTVIANKLTVMVHQAAEQGRVCTVGTHNGLEHSTFNMTIEPGRV
QALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALFYV
SSAINPILYNLVSANFRQVFLSTLACLCPGWRHRRKKRPTFSRKPNSMSSNHAFSTSATR
ETLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50366304
NameBDBM50366304
Synonyms:CHEMBL2369588
TypeSmall organic molecule
Emp. Form.C41H64N6O8
Mol. Mass.768.9823
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)CC1CC2CCC1C2)C(=O)N[C@@H](CC(C)C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a