BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-L-fucosidase I
LigandBDBM50072588
Substrate/Competitorn/a
Meas. Tech.ChEBML_33967
Ki 5.8±n/a nM
Citation Andrews, DBird, MCunningham, MWard, P Synthesis of and glycosidase inhibition by -l-homofuconojirimycin Bioorg Med Chem Lett3:2533-2536 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-L-fucosidase I
Name:Alpha-L-fucosidase I
Synonyms:Alpha-L-fucoside fucohydrolase | Tissue alpha-L-fucosidase
Type:PROTEIN
Mol. Mass.:53690.69
Organism:Homo sapiens
Description:ChEMBL_34088
Residue:466
Sequence:
MRAPGMRSRPAGPALLLLLLFLGAAESVRRAQPPRRYTPDWPSLDSRPLPAWFDEAKFGV
FIHWGVFSVPAWGSEWFWWHWQGEGRPQYQRFMRDNYPPGFSYADFGPQFTARFFHPEEW
ADLFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYG
LYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYW
NSTNFLSWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCEDKFKPQSLPDHKWEMCTSID
KFSWGYRRDMALSDVTEESEIISELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGK
WLSINGEAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTK
ITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50072588
NameBDBM50072588
Synonyms:(2S,3R,4R,5R,6S)-2-Hydroxymethyl-6-methyl-piperidine-3,4,5-triol | 2-hydroxymethyl-6-methyl-(2S,3R,4R,5R,6S)-hexahydro-3,4,5-pyridinetriol | CHEMBL69294
TypeSmall organic molecule
Emp. Form.C7H15NO4
Mol. Mass.177.1983
SMILESCC1NC(CO)[C@@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM50072588
Synonyms:(2S,3R,4R,5R,6S)-2-Hydroxymethyl-6-methyl-piperidine-3,4,5-triol | 2-hydroxymethyl-6-methyl-(2S,3R,4R,5R,6S)-hexahydro-3,4,5-pyridinetriol | CHEMBL69294
TypeSmall organic molecule
Emp. Form.C7H15NO4
Mol. Mass.177.1983
SMILESCC1NC(CO)[C@@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: