BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase B
LigandBDBM50027516
Substrate/Competitorn/a
Meas. Tech.ChEMBL_35336
IC50 1000000±n/a nM
Citation Luisa Sua rez-Gea, MGarci a-Lo pez, TPe rez, CHerranz, R Pseudopeptide inhibitors of aminopeptidases containing the [CH(CN)NH] surrogate as a transition-state MIMIC Bioorg Med Chem Lett4:1491-1496 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase B
Name:Aminopeptidase B
Synonyms:AP-B | Arginine aminopeptidase | Arginyl aminopeptidase | Cytosol aminopeptidase IV
Type:PROTEIN
Mol. Mass.:72401.87
Organism:Mus musculus
Description:ChEMBL_35337
Residue:650
Sequence:
MESGGPGNYSAAARRPLHSAQAVDVASASSFRAFEILHLHLDLRAEFGPPGPGPGSRGLS
GTATLELRCLLPEGASELRLDSHSCLEVTAATLRRGQPGDQQAPAEPVPFHTQPFSHYGQ
ALCVAFRQPCGAADRFELELTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFP
CFDTPAVKCTYSALIEVPDGFTAVMSADTWEKRGPNKFFFQMSHPIPSYLIALAIGDLAS
AEVGPRSRVWAEPCLIEAAKEEYSGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGM
ENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRIST
ILFGAAYTCLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKGYCF
VSYLAHLVGDQDQFDKFLKAYVDEFKFQSILAEDFLEFYLEYFPELKKKGVDSIPGFEFD
RWLNTPGWPPYLPDLSPGDSLMKPAEELAELWVTSEPDMQAIEAVAISTWKTYQLVYFLD
KILQKSPLPPGNVKKLGETYPKISNAQNAELRLRWGQIILKNDYQEEFQKVKDFLQSQGK
QKYTLPLYHAMMGGSEMARTLAKDTFAATASQLHSNVVNYVQQILAPKDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027516
NameBDBM50027516
Synonyms:2-(2-Amino-3-phenyl-propionylamino)-4-methyl-pentanoic acid | CHEMBL37879
TypeSmall organic molecule
Emp. Form.C15H22N2O3
Mol. Mass.278.3468
SMILESCC(C)C[C@H](NC(=O)[C@@H](N)Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a