BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene A4 hydrolase
LigandBDBM50285630
Substrate/Competitorn/a
Meas. Tech.ChEMBL_96940
IC50 10±n/a nM
Citation Penning, TDAskonas, LJDjuric, SWHaack, RAYu, SSMichener, MLKrivi, GGPyla, E Kelatorphan and related analogs: potent and selective inhibitors of leukotriene A4 hydrolase Bioorg Med Chem Lett5:2517-2522 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Leukotriene A4 hydrolase
Name:Leukotriene A4 hydrolase
Synonyms:LTA-4 hydrolase | Leukotriene A(4) hydrolase | Leukotriene A-4 hydrolase (LTA4H)
Type:Hydrolase; metalloprotease
Mol. Mass.:69280.41
Organism:Homo sapiens (Human)
Description:Human recombinant LTA4H.
Residue:611
Sequence:
MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDL
TIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETP
DPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGET
HPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
AMLVGKDLKVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50285630
NameBDBM50285630
Synonyms:(S)-2-((R)-2-Benzyl-3-hydroxycarbamoyl-propionylamino)-3-cyclohexyl-propionic acid | CHEMBL83291
TypeSmall organic molecule
Emp. Form.C20H28N2O5
Mol. Mass.376.4467
SMILESONC(=O)C[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC1CCCCC1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a