BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurotensin receptor 1
LigandBDBM50366427
Substrate/Competitorn/a
Meas. Tech.ChEBML_144282
Ki 0.150000±n/a nM
Citation Wustrow, DDavis, MAkunne, HCorbin, AWiley, JWise, LHeffner, T Reduced amide bond neurotensin 813 mimetics with potent in vivo activity Bioorg Med Chem Lett5:997-1002 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Neurotensin receptor 1
Name:Neurotensin receptor 1
Synonyms:NT-R-1 | Neurotensin 1 | Neurotensin receptor type 1
Type:Enzyme Catalytic Domain
Mol. Mass.:47237.04
Organism:MOUSE
Description:Neurotensin 1 NTSR1 MOUSE::A2ACT4
Residue:424
Sequence:
MHLNSSVQQGAPSEPGAQPFPHPQFGLETMLLALSLSNGSGNSSESILEPNSNLDVNTDI
YSKVLVTAVYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAM
PVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLM
SRSRTKKFISAIWLASALLAVPMLFTMGLQNRSADGQHPGGLVCTPTVDTATVKVVIQVN
TFMSFLFPMLIISILNTVIANKLTVMVHQAAEQGRGVCTVGTHNSLEHSTFNMSIEPGRV
QALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALFYV
SSAINPILYNLVSANFRQVFLSTLACLCPGWRRRRKKRPTFSRKPNSMSSNHAFSTSATR
ETLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50366427
NameBDBM50366427
Synonyms:CHEMBL1793865
TypeSmall organic molecule
Emp. Form.C38H66N8O7
Mol. Mass.746.98
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H]1CCCN1C(=O)[C@H](CCCCN)NC[C@@H](N)CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a