BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurotensin receptor 1
LigandBDBM50286864
Substrate/Competitorn/a
Meas. Tech.ChEBML_144282
Ki 0.100000±n/a nM
Citation Wustrow, DDavis, MAkunne, HCorbin, AWiley, JWise, LHeffner, T Reduced amide bond neurotensin 813 mimetics with potent in vivo activity Bioorg Med Chem Lett5:997-1002 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Neurotensin receptor 1
Name:Neurotensin receptor 1
Synonyms:NT-R-1 | Neurotensin 1 | Neurotensin receptor type 1
Type:Enzyme Catalytic Domain
Mol. Mass.:47237.04
Organism:MOUSE
Description:Neurotensin 1 NTSR1 MOUSE::A2ACT4
Residue:424
Sequence:
MHLNSSVQQGAPSEPGAQPFPHPQFGLETMLLALSLSNGSGNSSESILEPNSNLDVNTDI
YSKVLVTAVYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAM
PVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLM
SRSRTKKFISAIWLASALLAVPMLFTMGLQNRSADGQHPGGLVCTPTVDTATVKVVIQVN
TFMSFLFPMLIISILNTVIANKLTVMVHQAAEQGRGVCTVGTHNSLEHSTFNMSIEPGRV
QALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALFYV
SSAINPILYNLVSANFRQVFLSTLACLCPGWRRRRKKRPTFSRKPNSMSSNHAFSTSATR
ETLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50286864
NameBDBM50286864
Synonyms:(S)-2-{(S)-2-[(S)-2-({(R)-1-[5-Guanidino-2-(3-guanidino-propyl)-pentanoyl]-pyrrolidine-2-carbonyl}-amino)-3-(1H-indol-3-yl)-propionylamino]-3,3-dimethyl-butyrylamino}-4-methyl-pentanoic acid | CHEMBL6716
TypeSmall organic molecule
Emp. Form.C38H61N11O6
Mol. Mass.767.961
SMILESCC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H]1CCCN1C(=O)C(CCCNC(N)=N)CCCNC(N)=N)C(C)(C)C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a