BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-glutamylcysteine synthetase
LigandBDBM50287275
Substrate/Competitorn/a
Meas. Tech.ChEMBL_68752
Ki 9230±n/a nM
Citation Katoh, MHiratake, JKato, HOda, J Mechanism-based inactivation of E. coli -glutamylcysteine synthetase by phosphinic acid- and sulfoximine-based transition-state analogues Bioorg Med Chem Lett6:1437-1442 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Gamma-glutamylcysteine synthetase
Name:Gamma-glutamylcysteine synthetase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:72759.43
Organism:Homo sapiens (Human)
Description:ChEMBL_68753
Residue:637
Sequence:
MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDH
ENKKVRLVLSGEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTV
EANMRKRRKEATSILEENQALCTITSFPRLGCPGFTLPEVKPNPVEGGASKSLFFPDEAI
NKHPRFSTLTRNIRHRRGEKVVINVPIFKDKNTPSPFIETFTEDDEASRASKPDHIYMDA
MGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALSAASPFYRGYVSDIDCRWGVI
SASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTIDKEIYEQLLQ
EGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVL
QGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIPILNS
YLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYS
LILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50287275
NameBDBM50287275
Synonyms:2-ammonio-4-[(2-carboxylatobutyl)sulfonyl]butanoate
TypeSmall organic molecule
Emp. Form.C9H16NO6S
Mol. Mass.266.292
SMILESCCC(CS(=O)(=O)CCC([NH3+])C([O-])=O)C([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a