BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM50037996
Substrate/Competitorn/a
Meas. Tech.ChEBML_212327
pH7.5±n/a
Ki 690±n/a nM
Commentsextracted
Citation von der Saal, WKucznierz, RLeinert, HEngh, RA DERIVATIVES OF 4-AMINO-PYRIDINE AS SELECTIVE THROMBIN INHIBITORS Bioorg Med Chem Lett7:1283-1288 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin
Name:Trypsin I
Synonyms:Beta-Trypsin | Cationic trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:25790.52
Organism:Bos taurus (bovine)
Description:P00760
Residue:246
Sequence:
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50037996
NameBDBM50037996
Synonyms:1-[N-(naphthalen-2-ylsulfonyl)glycyl-4-carbamimidoyl-D-phenylalanyl]piperidine | CHEMBL51173 | N-[(R)-1-(4-Carbamimidoyl-benzyl)-2-oxo-2-piperidin-1-yl-ethyl]-2-(naphthalene-2-sulfonylamino)-acetamide | N-[1-(4-Carbamimidoyl-benzyl)-2-(3,4-dihydro-2H-pyridin-1-yl)-2-oxo-ethyl]-2-(naphthalene-2-sulfonylamino)-acetamide | N-[1-(4-Carbamimidoyl-benzyl)-2-oxo-2-piperidin-1-yl-ethyl]-2-(naphthalene-2-sulfonylamino)-acetamide | N-[1-(4-Carbamimidoyl-benzyl)-2-oxo-2-piperidin-1-yl-ethyl]-2-(naphthalene-2-sulfonylamino)-acetamide(NAPAP)
TypeSmall organic molecule
Emp. Form.C27H31N5O4S
Mol. Mass.521.631
SMILESNC(=N)c1ccc(C[C@@H](NC(=O)CNS(=O)(=O)c2ccc3ccccc3c2)C(=O)N2CCCCC2)cc1
Structure
n/a