BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate racemase
LigandBDBM26431
Substrate/Competitorn/a
Meas. Tech.ChEMBL_71842
Ki 56000±n/a nM
Citation Glavas, STanner, ME The inhibition of glutamate racemase by Bioorg Med Chem Lett7:2265-2270 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate racemase
Name:Glutamate racemase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:28313.31
Organism:Lactobacillus fermentum
Description:ChEMBL_71842
Residue:268
Sequence:
MDNRPIGVMDSGLGGLSVVRVIQQKLPNEEVIFVGDQGHFPYGTKDQAEVRQLALSIGAF
LLKHDVKMMVVACNTATAAALPALQAALPIPVIGVIEPGARAALAQDKKGPIGVIATTAT
TTAGAYPATIERLAPGTPVIAKATQPMVEIVEHGQTGTAKAQEVVSEQLMTFKEHPVKTL
IMGCTHFPFLAPEISKAVGPTVALVDPAKETVATAKSWLEQHQAMGNHAHPNYHLYSTGN
LPDLRAGVNKWLLSGHFDLGTAQIEEGD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26431
NameBDBM26431
Synonyms:(2R)-2-aminopentanedioic acid | CHEMBL76232 | D-Glu | D-Glutamate | D-[14C]Glu
Typeradiolabeled amino acid
Emp. Form.C5H9NO4
Mol. Mass.147.1293
SMILESN[C@H](CCC(O)=O)C(O)=O
Structure
n/a