Reaction Details |
 | Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50290387 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_146485 |
---|
Ki | 0.780000±n/a nM |
---|
Citation | Schmidhammer, H; Daurer, D; Wieser, M; Monory, K; Borsodi, A; Elliott, J; Traynor, JR Synthesis and biological evaluation of 14-alkoxymorphinans. 14.1 14-ethoxy-5-methyl substituted indolomorphinans with opioid receptor selectivity Bioorg Med Chem Lett7:151-156 (1997) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50290387 |
---|
Name | BDBM50290387 |
Synonyms: | 22-cyclopropylmethyl-2-ethoxy-13-methyl-14-oxa-11,22-diazaheptacyclo[13.9.1.01,13.02,21.04,12.05,10.019,25]pentacosa-4(12),5(10),6,8,15,17,19(25)-heptaen-16-ol; with Hydrochloric Acid | CHEMBL558004 |
Type | Small organic molecule |
Emp. Form. | C29H32N2O3 |
Mol. Mass. | 456.576 |
SMILES | CCO[C@]12Cc3c([nH]c4ccccc34)[C@]3(C)Oc4c5c(CC1N(CC1CC1)CC[C@@]235)ccc4O |r,THB:30:19:3:22.28.27,17:18:3:22.28.27| |
Structure |  |
n/a |
---|