Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 Receptor
LigandBDBM50075818
Substrate/Competitorn/a
Meas. Tech.ChEMBL_215014
Kd 421±n/a nM
Citation Tóth, GKBakos, KPenke, BPávó, IVarga, CTörök, GPéter, AFülöp, F Synthesis of oxytocin antagonists containing conformationally constrained amino acids in position 2. Bioorg Med Chem Lett9:667-72 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 Receptor
Name:Vasopressin receptor
Synonyms:AVPR V2 | Antidiuretic hormone receptor | Renal-type arginine vasopressin receptor | VASOPRESSIN V2
Type:G-protein coupled receptor
Mol. Mass.:40761.85
Organism:Rattus norvegicus (Rat)
Description:n/a
Residue:371
Sequence:
MLLVSTVSAVPGLFSPPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLG
ALIRRGRRGRWAPMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQ
RDVGNGSGVFDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLVPGP
SERAGRRRRGRRTGSPSEGAHVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEA
PLERPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCAQRHTTHSLGPQDESCAT
ASSSLMKDTPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50075818
n/a
NameBDBM50075818
Synonyms:CHEMBL157988 | Mpa1,D-Phe2,Sar7AVT
TypeSmall organic molecule
Emp. Form.C41H63N13O12S2
Mol. Mass.994.149
SMILESCC[C@H](C)[C@@H]1NC(=O)[C@H](Cc2ccccc2)NC(=O)CCSSC[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](CCC(N)=O)NC1=O)C(=O)N(C)CC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: