Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosinetriphosphatase
LigandBDBM50086849
Substrate/Competitorn/a
Meas. Tech.ChEBML_148285
IC50 4900±n/a nM
Citation Edvinsson, KMHerslöf, MHolm, PKann, NKeeling, DJMattsson, JPNordén, BShcherbukhin, V Solid phase synthesis of diamides as potential bone resorption inhibitors. Bioorg Med Chem Lett10:503-7 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosinetriphosphatase
Name:Adenosinetriphosphatase
Synonyms:Uncharacterized protein | Vacuolar H-ATPase B subunit osteoclast isozyme
Type:PROTEIN
Mol. Mass.:55043.78
Organism:Gallus gallus
Description:ChEMBL_148284
Residue:496
Sequence:
RRMVNGAGPGGAREQAAALTRDFLSQPRLTYKTVSGVNGPLVILDQVKFPRYAEIVHLTL
PDGTRRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSG
KPIDRGPAVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAG
LPHNEIAAQICRQAGLVKKSKDVMDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDN
VCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREE
VPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQ
IYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSNQLYACYAIGKDVQAMK
AVVGEEALTSDDLLYLEFLQKFEKNFIAQGPYENRTVYETLDIGWQLLRIFPKEMLKRIP
QTTLAEFYPRDSTAKH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086849
NameBDBM50086849
Synonyms:3-[(3,4-Dichloro-phenylcarbamoyl)-methyl]-N-(2,2,6,6-tetramethyl-piperidin-4-yl)-benzamide | CHEMBL147307
TypeSmall organic molecule
Emp. Form.C24H29Cl2N3O2
Mol. Mass.462.412
SMILESCC1(C)CC(CC(C)(C)N1)NC(=O)c1cccc(CC(=O)Nc2ccc(Cl)c(Cl)c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a