Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2A adrenergic receptor
LigandBDBM50087151
Substrate/Competitorn/a
Meas. Tech.ChEBML_33064
Ki 0.390000±n/a nM
Citation Zheng, WLei, LLalchandani, SSun, GFeller, DRMiller, DD Yohimbine dimers exhibiting binding selectivities for human alpha2a- versus alpha2b-adrenergic receptors. Bioorg Med Chem Lett10:627-30 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-2A adrenergic receptor
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:Adrenergic alpha2A | Adrenergic receptor alpha | Alpha-2 adrenergic receptor subtype C10 | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | alpha-2A adrenergic receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:48979.91
Organism:Homo sapiens (Human)
Description:P08913
Residue:450
Sequence:
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG
PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA
APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087151
NameBDBM50087151
Synonyms:1N-{10-[2-hydroxy-(1R,2S,4aR,13bS,14aS)-1,2,3,4,4a,5,7,8,13,13b,14,14a-dodecahydroisoquino[3,2-a]b-carbolin-1-ylcarboxamido]decyl}-2-hydroxy-(1R,2S,4aR,13bS,14aS)-1,2,3,4,4a,5,7,8,13,13b,14,14a-dodecahydroisoquino[3, ;dihydrochloride | CHEMBL554019
TypeSmall organic molecule
Emp. Form.C50H68N6O4
Mol. Mass.817.1127
SMILESO[C@H]1CC[C@H]2CN3CCc4c([nH]c5ccccc45)[C@@H]3C[C@@H]2[C@H]1C(=O)NCCCCCCCCCCNC(=O)[C@H]1[C@@H](O)CC[C@H]2CN3CCc4c([nH]c5ccccc45)[C@@H]3C[C@H]12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a