Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50101162
Substrate/Competitorn/a
Meas. Tech.ChEBML_146509
Ki>10000±n/a nM
Citation Wentland, MPLou, RDehnhardt, CMDuan, WCohen, DJBidlack, JM 3-Carboxamido analogues of morphine and naltrexone. synthesis and opioid receptor binding properties. Bioorg Med Chem Lett11:1717-21 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:mu/kappa opioid receptor
Synonyms:Kappa Opioid Receptor | OPIATE Kappa | Opiate Kappa 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42744.99
Organism:Cavia porcellus (domestic guinea pig)
Description:P41144
Residue:380
Sequence:
MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRV
RNTVQDPAYMRNVDGVNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50101162
NameBDBM50101162
Synonyms:4,10N-dimethyl-14-hydroxy-(1S,5R,17R)-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7,9,11(18),15-tetraene-10-carboxamide | CHEMBL49029
TypeSmall organic molecule
Emp. Form.C19H22N2O3
Mol. Mass.326.3896
SMILESCNC(=O)c1ccc2C[C@@H]3[C@@H]4C=CC(O)C5Oc1c2[C@]45CCN3C |c:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a