Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 3
LigandBDBM50102113
Substrate/Competitorn/a
Meas. Tech.ChEMBL_106391
EC50 37000±n/a nM
Citation Mukhopadhyaya, JKKozikowski, APGrajkowska, EPshenichkin, SWroblewski, JT Synthesis of N(1)-substituted analogues of (2R,4R)-4-amino-pyrrolidine-2,4-dicarboxylic acid as agonists, partial agonists, and antagonists of group II metabotropic glutamate receptors. Bioorg Med Chem Lett11:1919-24 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 3
Name:Metabotropic glutamate receptor 3
Synonyms:Gprc1c | Grm3 | Mglur3 | glutamate receptor, metabotropic 3 precursor | mGluR3
Type:Protein
Mol. Mass.:98971.84
Organism:Rattus norvegicus (Rat)
Description:P31422
Residue:879
Sequence:
MKMLTRLQILMLALFSKGFLLSLGDHNFMRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVAS
DGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
CSLQNKRNHRQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKILDGKKLYKEYLLKINFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSY
LKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
VDEFTCMDCGPGQWPTADLSGCYNLPEDYIKWEDAWAIGPVTIACLGFLCTCIVITVFIK
HNNTPLVKASGRELCYILLFGVSLSYCMTFFFIAKPSPVICALRRLGLGTSFAICYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILETPGTRRYTLP
EKRETVILKCNVKDSSMLISLTYDVVLVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIVLFQPQKNVVTHRLH
LNRFSVSGTATTYSQSSASTYVPTVCNGREVLDSTTSSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50102113
n/a
NameBDBM50102113
Synonyms:(2R,4R)-4-amino-1-(pyridin-2-ylmethyl)pyrrolidine-2,4-dicarboxylic acid trihydrochloride | CHEMBL543811
TypeSmall organic molecule
Emp. Form.C12H15N3O4
Mol. Mass.265.2652
SMILESN[C@@]1(C[C@@H](N(Cc2ccccn2)C1)C(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: