Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-galactosidase
LigandBDBM50104296
Substrate/Competitorn/a
Meas. Tech.ChEMBL_37300
Ki 25000±n/a nM
Citation Popowycz, FGerber-Lemaire, SDemange, RRodriguez-García, EAsenjo, ATRobina, IVogel, P Derivatives of (2R,3R,4S)-2-aminomethylpyrrolidine-3,4-diol are selective alpha-mannosidase inhibitors. Bioorg Med Chem Lett11:2489-93 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Beta-galactosidase
Name:Beta-galactosidase
Synonyms:Acid beta-galactosidase | Elastin receptor 1 | Lactase
Type:PROTEIN
Mol. Mass.:76074.43
Organism:Homo sapiens
Description:ChEMBL_215886
Residue:677
Sequence:
MPGFLVRILPLLLVLLLLGPTRGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRV
PRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVIL
RPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPV
ITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTV
DFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARG
ASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKV
PEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRT
TLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENM
GRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWA
HNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLT
LFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKR
LMPPPPQKNKDSWLDHV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104296
n/a
NameBDBM50104296
Synonyms:2-(2,2-Dihydroxy-ethyl)-pyrrolidine-3,4-diol | CHEMBL83278
TypeSmall organic molecule
Emp. Form.C6H13NO4
Mol. Mass.163.1717
SMILESOC(O)CC1NCC(O)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: