Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-mannosidase
LigandBDBM50104307
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32362
Ki 71000±n/a nM
Citation Popowycz, FGerber-Lemaire, SDemange, RRodriguez-García, EAsenjo, ATRobina, IVogel, P Derivatives of (2R,3R,4S)-2-aminomethylpyrrolidine-3,4-diol are selective alpha-mannosidase inhibitors. Bioorg Med Chem Lett11:2489-93 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-mannosidase
Name:Alpha-mannosidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:65344.50
Organism:Glycine max
Description:ChEMBL_32380
Residue:578
Sequence:
MARGSRSVGSSSSKWRYCNPSYYLKRPKRLALLFIVFVCVSFVFWDRQTLVREHQVEISE
LQKEVTDLKNLVDDLNNKQGGTSGKTDLGRKATKSSKDVLDDPIDIERREKVKEAMLHAW
GSYEKYAWGQDELQPQSKNGVNSFGGLGATLIDSLDTLYIMGLNEQFQKAREWVANSLDF
NKDYEASVFETTIRVVGGLLSAYDLSGDKVFLDKAIEIADRLLPAWNTPTGIPYNIINLS
HGRAHNPSWTGGESILADSGTEQLEFIVLSQRTGDLKYQQKVENVIAQLNKTFPDDGLLP
IYINPHSGAAGYSPITFGAMGDSFYEYLLKVWIQGNKTSSIKHYRDMWEKSMKGLSSLIR
RSTPSSFTYICEKNGGSLTDKMDELACFAPGMIALGSFGYSAADDSQKFLSLAEELAWTC
YNFYQSTPTKLAGENYFFHSGQDMSVGTSWNILRPETVESLFYLWRLTGNKTYQEWGWNI
FQAFEKNSRIESGYVGLKDVNSGVKDNMMQSFFLAETLKYFYLLFSPSSVISLDEWVFNT
EAHPLRIVTRHEEGLVKNLNEKQKPFSRIGGRKEGRSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104307
NameBDBM50104307
Synonyms:2-(Benzylamino-methyl)-pyrrolidine-3,4-diol | CHEMBL84104
TypeSmall organic molecule
Emp. Form.C12H18N2O2
Mol. Mass.222.2835
SMILESOC1CNC(CNCc2ccccc2)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a