Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine deaminase
LigandBDBM50034908
Substrate/Competitorn/a
Meas. Tech.ChEBML_30789
Ki 10±n/a nM
Citation Wang, LHosmane, RS A unique ring-expanded acyclic nucleoside analogue that inhibits both adenosine deaminase (ADA) and guanine deaminase (GDA; guanase): synthesis and enzyme inhibition studies of 4,6-diamino-8H-1-hydroxyethoxymethyl-8-iminoimidazo[4,5-e][1,3]diazepine. Bioorg Med Chem Lett11:2893-6 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine deaminase
Name:Adenosine deaminase
Synonyms:ADA | Adenosine aminohydrolase
Type:Enzyme
Mol. Mass.:40910.44
Organism:Bos taurus (bovine)
Description:n/a
Residue:363
Sequence:
MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPE
FLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAI
DLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGY
HTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIF
KSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAE
QCL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034908
NameBDBM50034908
Synonyms:(2R,3S)-3-((R)-6-Amino-purin-9-yl)-nonan-2-ol | (2R,3S)-3-(6-Amino-purin-9-yl)-nonan-2-ol | (2R,3S)-3-(6-amino-9H-purin-9-yl)nonan-2-ol | (EHNA)3-(6-Amino-purin-9-yl)-nonan-2-ol | 3-(6-Amino-purin-9-yl)-nonan-2-ol | 3-(6-Amino-purin-9-yl)-nonan-2-ol(EHNA) | CHEMBL50378
TypeSmall organic molecule
Emp. Form.C14H23N5O
Mol. Mass.277.3653
SMILESCCCCCC[C@@H]([C@@H](C)O)n1cnc2c(N)ncnc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a